PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29889.m003245
Common NameLOC8262611, RCOM_0999330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 682aa    MW: 74828.9 Da    PI: 5.9628
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29889.m003245genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.3e-29213266155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  29889.m003245 213 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                    79*******************.********************************8 PP

2Response_reg77.83.9e-26351431109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vdD+p+ +++l+++l+   y ev+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a ++++ + + +  Ga
  29889.m003245  35 VLVVDDDPTCLMILEKMLRTCLY-EVTKCNRAETALSLLRENKngYDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADEAKSVVMKGVTHGA 128
                    89*********************.***************999999**********************6654.8*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +e+l +
  29889.m003245 129 CDYLIKPVRIEALKN 143
                    ***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.3E-18310672IPR017053Response regulator B-type, plant
SuperFamilySSF521724.41E-3532157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.8E-4232175No hitNo description
SMARTSM004484.6E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.8434149IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.8E-2335143IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.78E-2736148No hitNo description
SuperFamilySSF466893.76E-20210270IPR009057Homeodomain-like
PROSITE profilePS5129411.048210269IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-30212271IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25213266IPR006447Myb domain, plants
PfamPF002499.8E-8215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0016310Biological Processphosphorylation
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MNLSNGKGSM STASSSVAWK AGEVVPDQFP AGLRVLVVDD DPTCLMILEK MLRTCLYEVT  60
KCNRAETALS LLRENKNGYD IVISDVHMPD MDGFKLLEHI GLEMDLPVIM MSADEAKSVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KKRNEWKDLE QSGSVEEGDR QPKQSEDADY  180
SSSANEGNWR NSKKRKDEEE EGDERDDTST LKKPRVVWSV ELHQQFVAAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHQNN LGNAFISPQE ATYGPLSSFN  300
GIDLQTLAAT GQLPAQSLAT LQAAGLGRSA VKSRMPIPIV DQRNLFSFEN PKLRFGEGQQ  360
QQLNNSKQMN LLHGIPTSME PKQLANIHHS AQSIGSMNMQ VNAHGGQGGQ SNSLLMQMSQ  420
SQSRGQMLNE TCVTHVPALP SSIGQPVIST AIAGGVLARN GLAESRGAVY NSVSQSSSII  480
NFPLNNTSEL SGNSFPLASN PGISSLTTKG AFQEEDNSEI KGSVGFMPSY DIFSDLNQHK  540
SHDWELQNVG ITFNASQQNN SLQRNLDVEP SVFSHQRFSS NQRTVPNRNM SVMGKPMFST  600
GDATDHVNVQ SAGQHVNTFF AENSARVKSE PIADANCQTN LFPEQFGQED LMSALLKQQQ  660
GGVGPAENDF DFDGYPLDNI PV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22212272464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519174.10.0PREDICTED: two-component response regulator ARR2 isoform X1
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLB9RZK50.0B9RZK5_RICCO; Sensor histidine kinase, putative
STRINGPOPTR_0008s22990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2